(data stored in ACNUC1104 zone)

EMBL: CP000959.PE576

CP000959.PE576       Location/Qualifiers
FT   CDS             complement(676468..676896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3765"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bur:Bcep18194_B2341 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3765"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92917"
FT                   /db_xref="GOA:B1K4Z3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Z3"
FT                   /protein_id="ACA92917.1"
FT                   /translation="MNDTSIAQACNCLALRQAARFVTQLYERHLAPVGVTPAQFSIMAN
FT                   LTRHPGLLMSELAEMLVMDRTTLLRALKPLQRDGFVSTAASEHDARAHALHLTKLGERT
FT                   FAQAKVAWQAAQDEFDMQFGRERAKALRNELFSLTAER"
     MNDTSIAQAC NCLALRQAAR FVTQLYERHL APVGVTPAQF SIMANLTRHP GLLMSELAEM        60
     LVMDRTTLLR ALKPLQRDGF VSTAASEHDA RAHALHLTKL GERTFAQAKV AWQAAQDEFD       120
     MQFGRERAKA LRNELFSLTA ER                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page