(data stored in ACNUC1104 zone)

EMBL: CP000959.PE577

CP000959.PE577       Location/Qualifiers
FT   CDS             676989..677909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3766"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2342
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3766"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92918"
FT                   /db_xref="GOA:B1K4Z4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Z4"
FT                   /protein_id="ACA92918.1"
FT                   /translation="MDYIDKLRIFRSVVEMRSFTRAADMHGLARPVVSRAVADLEARFG
FT                   SRLLHRTTRQVSLTETAERIYERCAAVLDELDALEVEAQTHTREPEGLLRLVAHTTAAL
FT                   NRLVPLIAGFKSAHPNVRLDVTLTERPVDLVGEGYDIGIVVPYMLTSESTVVRLVERIP
FT                   VVIVATPAYLQAHARPETPADLANHPFVPISPSLRRPALSFRVDGNLLTVPFRFDISSN
FT                   SPVFNREMVMHDFGIGVVPKTLVEAELASGALVQLLEDADLVDAFVEIKLAYANRALLP
FT                   AKVKAFIDHTAAYCDREGWIVPAAA"
     MDYIDKLRIF RSVVEMRSFT RAADMHGLAR PVVSRAVADL EARFGSRLLH RTTRQVSLTE        60
     TAERIYERCA AVLDELDALE VEAQTHTREP EGLLRLVAHT TAALNRLVPL IAGFKSAHPN       120
     VRLDVTLTER PVDLVGEGYD IGIVVPYMLT SESTVVRLVE RIPVVIVATP AYLQAHARPE       180
     TPADLANHPF VPISPSLRRP ALSFRVDGNL LTVPFRFDIS SNSPVFNREM VMHDFGIGVV       240
     PKTLVEAELA SGALVQLLED ADLVDAFVEI KLAYANRALL PAKVKAFIDH TAAYCDREGW       300
     IVPAAA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page