(data stored in ACNUC1104 zone)

EMBL: CP000959.PE578

CP000959.PE578       Location/Qualifiers
FT   CDS             678019..678450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3767"
FT                   /product="regulatory protein MarR"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bur:Bcep18194_B2343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3767"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92919"
FT                   /db_xref="GOA:B1K4Z5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Z5"
FT                   /protein_id="ACA92919.1"
FT                   /translation="MHKTTLTDDDCFAVRQAARRISQFYERYLSRAGVTPSQYSILALL
FT                   RDRPGLTMATLSNVLVIERTALLRALKPLVGAALVTGRIEPPCRGQTFALTAHGETKVA
FT                   DAHVHWLAAQEAFERCFGSAQAARLRDELFRITHNLPER"
     MHKTTLTDDD CFAVRQAARR ISQFYERYLS RAGVTPSQYS ILALLRDRPG LTMATLSNVL        60
     VIERTALLRA LKPLVGAALV TGRIEPPCRG QTFALTAHGE TKVADAHVHW LAAQEAFERC       120
     FGSAQAARLR DELFRITHNL PER                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page