(data stored in ACNUC1104 zone)

EMBL: CP000959.PE579

CP000959.PE579       Location/Qualifiers
FT   CDS             678515..679609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3768"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bur:Bcep18194_B2344 secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3768"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92920"
FT                   /db_xref="GOA:B1K4Z6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Z6"
FT                   /protein_id="ACA92920.1"
FT                   /translation="MDTTQDAASSREAATTERPAKQQRRVPWMRIAVGAVVVVVAAAAL
FT                   DWLFVLRFQESTDDAYVGGDVTVLAPKVNGFVDKILVTDNQRVKAGDVLVQLDARDYDA
FT                   KLAQASAEVDSARSAVTELEAKQQLQFAVIGQHAADKNASSAELTRAASDRVRYRELVK
FT                   SDAVSNQIVERADADYSKAGAAVERSDAALLASKRQLDVLGAQLADARARVNTALAAQR
FT                   VAALNVEYTTIRSPVDGYVGNRTGRVGMLANVGVPLLTVVPASGLWIDANFKEDQLRKM
FT                   RAGDRVDVALDASSTRLHGRVDSLAPATGATFSVLPPENATGNFTKIVQRVPVRVHLDP
FT                   QPGIKHVLRPGLSAVVTVHTDHKN"
     MDTTQDAASS REAATTERPA KQQRRVPWMR IAVGAVVVVV AAAALDWLFV LRFQESTDDA        60
     YVGGDVTVLA PKVNGFVDKI LVTDNQRVKA GDVLVQLDAR DYDAKLAQAS AEVDSARSAV       120
     TELEAKQQLQ FAVIGQHAAD KNASSAELTR AASDRVRYRE LVKSDAVSNQ IVERADADYS       180
     KAGAAVERSD AALLASKRQL DVLGAQLADA RARVNTALAA QRVAALNVEY TTIRSPVDGY       240
     VGNRTGRVGM LANVGVPLLT VVPASGLWID ANFKEDQLRK MRAGDRVDVA LDASSTRLHG       300
     RVDSLAPATG ATFSVLPPEN ATGNFTKIVQ RVPVRVHLDP QPGIKHVLRP GLSAVVTVHT       360
     DHKN                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page