(data stored in ACNUC1104 zone)

EMBL: CP000959.PE58

CP000959.PE58        Location/Qualifiers
FT   CDS             complement(66591..67661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3243"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bur:Bcep18194_B1735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3243"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92399"
FT                   /db_xref="GOA:B1K8Q2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8Q2"
FT                   /protein_id="ACA92399.1"
FT                   /translation="MGAHVPSSHDSAARPRVQQIARVALYAALLLLALWVIRDFIPAIA
FT                   WACVIAIAMWPLLKRFESHRLFRSRPTLIATVITAAISLLVVLPVAVATTQAIAQAHDL
FT                   REWLHSIQDNGIPLPDVISRLPYGAAQITEWWQANLGHPLHAATAMHGVNSEKFIAFGR
FT                   QFGTKLAHVLLEFGFMLVTLFVILRAGHKLSGALLQGARRAFGRNGAELIERMVAAVYG
FT                   TVTGLVVVGLGEGALLGVAYALAGVPHAALLGLVTAVAAMLPFCAPVVFCGAALWLFVQ
FT                   GATMWAVVVAALGFIVVFVAEHFVRPVLIGGSTRLPFLLVLFGILGGAETFGLIGLFVG
FT                   PALMTVLTMLWAEWIA"
     MGAHVPSSHD SAARPRVQQI ARVALYAALL LLALWVIRDF IPAIAWACVI AIAMWPLLKR        60
     FESHRLFRSR PTLIATVITA AISLLVVLPV AVATTQAIAQ AHDLREWLHS IQDNGIPLPD       120
     VISRLPYGAA QITEWWQANL GHPLHAATAM HGVNSEKFIA FGRQFGTKLA HVLLEFGFML       180
     VTLFVILRAG HKLSGALLQG ARRAFGRNGA ELIERMVAAV YGTVTGLVVV GLGEGALLGV       240
     AYALAGVPHA ALLGLVTAVA AMLPFCAPVV FCGAALWLFV QGATMWAVVV AALGFIVVFV       300
     AEHFVRPVLI GGSTRLPFLL VLFGILGGAE TFGLIGLFVG PALMTVLTML WAEWIA           356
//

If you have problems or comments...

PBIL Back to PBIL home page