(data stored in ACNUC1104 zone)

EMBL: CP000959.PE581

CP000959.PE581       Location/Qualifiers
FT   CDS             681216..682658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3770"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bur:Bcep18194_B2346 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3770"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92922"
FT                   /db_xref="GOA:B1K4Z8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Z8"
FT                   /protein_id="ACA92922.1"
FT                   /translation="MKKLLVALAVSAFAAGCAVQPAQHPALNDSVQTLAPTAWDTDVPR
FT                   ADIDAAAWWAQFHDPVLDRLIATVLDSNLDLQAAAERVKQAQALTVQKRAVLLPELDAT
FT                   AHAADARQNTPPPLGYVRQAGAGLALSWSPDVFGGERLDLLAAQAELVGQKHAEDAMRL
FT                   ALAADAASAYVDLRWAQQELKILQDNAKIRQHALELTRKRQAFGLSTELDVTRAQNQLD
FT                   ALEARIPPTQAQISHQLNLIAVYSGRTPESVDRLLLAQAGEIPAPPVGAPGTLPSQALL
FT                   RRPDVLTAYAQVERRAAQVGVAKAERYPKFSLNLTDGILAASYLGLPTLTDNLFSAALS
FT                   ATSPIFNAGRITADISQSESRMRESELGLRQTMLQALREVEDARANLVSSDEATRRLGS
FT                   ALAASDKALGLANQLYKGGATDFLDVLSAQEVYLRDSDSLNQVKREHALAAVALYRSLG
FT                   GGWSRNDAAGGTQTETDAVAKN"
     MKKLLVALAV SAFAAGCAVQ PAQHPALNDS VQTLAPTAWD TDVPRADIDA AAWWAQFHDP        60
     VLDRLIATVL DSNLDLQAAA ERVKQAQALT VQKRAVLLPE LDATAHAADA RQNTPPPLGY       120
     VRQAGAGLAL SWSPDVFGGE RLDLLAAQAE LVGQKHAEDA MRLALAADAA SAYVDLRWAQ       180
     QELKILQDNA KIRQHALELT RKRQAFGLST ELDVTRAQNQ LDALEARIPP TQAQISHQLN       240
     LIAVYSGRTP ESVDRLLLAQ AGEIPAPPVG APGTLPSQAL LRRPDVLTAY AQVERRAAQV       300
     GVAKAERYPK FSLNLTDGIL AASYLGLPTL TDNLFSAALS ATSPIFNAGR ITADISQSES       360
     RMRESELGLR QTMLQALREV EDARANLVSS DEATRRLGSA LAASDKALGL ANQLYKGGAT       420
     DFLDVLSAQE VYLRDSDSLN QVKREHALAA VALYRSLGGG WSRNDAAGGT QTETDAVAKN       480
//

If you have problems or comments...

PBIL Back to PBIL home page