(data stored in ACNUC1104 zone)

EMBL: CP000959.PE584

CP000959.PE584       Location/Qualifiers
FT   CDS             complement(685177..686145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3774"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_5171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3774"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92925"
FT                   /db_xref="GOA:B1K501"
FT                   /db_xref="UniProtKB/TrEMBL:B1K501"
FT                   /protein_id="ACA92925.1"
FT                   /translation="MAFDGHSRYKLNRPVTDTESSARLHVNERRTDSAKSVGTVFKATD
FT                   SYLEVCDGLYREKGWGLLAFSTAGILFFCLIAMFLWIATHMPIAVRAKGQQGIVYFLLA
FT                   IFSLIGIGGLAVTVRALLIDCFNYTRKPIRFNRLDRKIYAFRHNGPGGVFSVPWDSAFL
FT                   YVERKPKAGLAGTAPRVVRCLVLNDEGLVVGTFSVGKYVELAFEENSPAGQQAMEELYQ
FT                   DFEYYRRFMEEGPSAVPPVAEFLTTEVSFRNSLKLQFDGASDLLKSGNPVMSLVTIIAA
FT                   LPTFILAVAYYIAQRTCREPVWPEEVERACNAATPSNGLTA"
     MAFDGHSRYK LNRPVTDTES SARLHVNERR TDSAKSVGTV FKATDSYLEV CDGLYREKGW        60
     GLLAFSTAGI LFFCLIAMFL WIATHMPIAV RAKGQQGIVY FLLAIFSLIG IGGLAVTVRA       120
     LLIDCFNYTR KPIRFNRLDR KIYAFRHNGP GGVFSVPWDS AFLYVERKPK AGLAGTAPRV       180
     VRCLVLNDEG LVVGTFSVGK YVELAFEENS PAGQQAMEEL YQDFEYYRRF MEEGPSAVPP       240
     VAEFLTTEVS FRNSLKLQFD GASDLLKSGN PVMSLVTIIA ALPTFILAVA YYIAQRTCRE       300
     PVWPEEVERA CNAATPSNGL TA                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page