(data stored in ACNUC1104 zone)

EMBL: CP000959.PE585

CP000959.PE585       Location/Qualifiers
FT   CDS             complement(686157..688718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3775"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_3916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3775"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92926"
FT                   /db_xref="GOA:B1K502"
FT                   /db_xref="UniProtKB/TrEMBL:B1K502"
FT                   /protein_id="ACA92926.1"
FT                   /translation="MALDTNFASISQLTQSAMQTSSRAPNSCNMCKKKGLPILPVRYGV
FT                   VANSKAHSSAGAMSLMGGKFGDGVVGIALKKAKYTLRTLRYGYVYIFYPKTQRWQIYAV
FT                   TAEGYLYDYPVGIKLDRSFEKPFSCHQPGHAQLAQCITIEDAEHAGTVYLAFSDELWTQ
FT                   KVRDTYAKNFMGCRDKRMQKFDATAWYNGSMNQPHADSVDHLEGLLSEYKGGRPDALVT
FT                   GCFPYHDRAGQQPALKKAMDSILPDKGLFFALWDPVGITQELNFEQRVAFGAALAPYEH
FT                   GIWAASAIDALQKAVAVSAKEDVERAAGMLEANTYEGMGLGALFDGGKALEKRLKSIEA
FT                   QKESELATAGPEAWKPYTTHYRQQAIVDFRQQMANAMKSEQASTLIPLSQDHQAWLSSA
FT                   ALLNVFESDYEPGSWRCGLNYTNTFTRCIEGSADRKEVLDVLVKWAKGSVSDTRNPLLR
FT                   AFVLNSPVLAEKVKEASSYPYMELREFVAKLIESYSKIEQVEDSKDKGIKVAVAKSLAR
FT                   LLHETGGPVVQAVSTGVETAAAKTLYVTLCMRTKQLFEFKVVYGSVNQWVNYIARQMQE
FT                   MMPGRQKISVQDLKKQLQDKASVGGGVDAEIKAKQFVPVESPTTEAAALASVKAKPGFE
FT                   KLASATLTPDVVETIYMPKFRLMTKGEPGFAGIGAIFSAINLRFAREELKKANRFNQTE
FT                   AGIKFDNAVGGLVAGVAQYGSSALEQMEKAGVKLSESTAKVGRFLGIVGRFGGAIVGLV
FT                   SAAIDAYHAYDELEHGNILMFALYTTSALIGGALVVAAFLGSVLTLPLLLLAALIGVLI
FT                   NYFKSREVDDWLEQCYFGIKATSERFEHLEEDRKAFTAIFS"
     MALDTNFASI SQLTQSAMQT SSRAPNSCNM CKKKGLPILP VRYGVVANSK AHSSAGAMSL        60
     MGGKFGDGVV GIALKKAKYT LRTLRYGYVY IFYPKTQRWQ IYAVTAEGYL YDYPVGIKLD       120
     RSFEKPFSCH QPGHAQLAQC ITIEDAEHAG TVYLAFSDEL WTQKVRDTYA KNFMGCRDKR       180
     MQKFDATAWY NGSMNQPHAD SVDHLEGLLS EYKGGRPDAL VTGCFPYHDR AGQQPALKKA       240
     MDSILPDKGL FFALWDPVGI TQELNFEQRV AFGAALAPYE HGIWAASAID ALQKAVAVSA       300
     KEDVERAAGM LEANTYEGMG LGALFDGGKA LEKRLKSIEA QKESELATAG PEAWKPYTTH       360
     YRQQAIVDFR QQMANAMKSE QASTLIPLSQ DHQAWLSSAA LLNVFESDYE PGSWRCGLNY       420
     TNTFTRCIEG SADRKEVLDV LVKWAKGSVS DTRNPLLRAF VLNSPVLAEK VKEASSYPYM       480
     ELREFVAKLI ESYSKIEQVE DSKDKGIKVA VAKSLARLLH ETGGPVVQAV STGVETAAAK       540
     TLYVTLCMRT KQLFEFKVVY GSVNQWVNYI ARQMQEMMPG RQKISVQDLK KQLQDKASVG       600
     GGVDAEIKAK QFVPVESPTT EAAALASVKA KPGFEKLASA TLTPDVVETI YMPKFRLMTK       660
     GEPGFAGIGA IFSAINLRFA REELKKANRF NQTEAGIKFD NAVGGLVAGV AQYGSSALEQ       720
     MEKAGVKLSE STAKVGRFLG IVGRFGGAIV GLVSAAIDAY HAYDELEHGN ILMFALYTTS       780
     ALIGGALVVA AFLGSVLTLP LLLLAALIGV LINYFKSREV DDWLEQCYFG IKATSERFEH       840
     LEEDRKAFTA IFS                                                          853
//

If you have problems or comments...

PBIL Back to PBIL home page