(data stored in ACNUC1104 zone)

EMBL: CP000959.PE587

CP000959.PE587       Location/Qualifiers
FT   CDS             complement(689563..692115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3777"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; KEGG:
FT                   bvi:Bcep1808_0451 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3777"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92928"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B1K504"
FT                   /protein_id="ACA92928.1"
FT                   /translation="MGRLPNSLMLDAGIEQTNRALVLETPLGAKVLLPQRAMGESRVGR
FT                   DFELTVDVVSRERALHLKKLMAQPVTLWVRQADESYLPWHGYVHATRRLGADGGLTYYQ
FT                   LSFSSWMRFLQYRKDARIFQDLTTADILTKVFSGHSQARGHFRLDVKDPGAVRSYCTQY
FT                   ETDHNFVHRLMESEGWFTYVEHAEDGKSHTIVVTDDLFNCKALATQRVPFYRGDRDGQA
FT                   GTLVEWSGERTTQSVGYAFSTADYKRPARTLQRADRSTVDQGDIPQELEVYEYAGHYSF
FT                   PVTGESYDRGERAMRIRLEEMASRSKRFFGVGSVSCMDAGRWFTLEDHPEHDADKPEDR
FT                   EFAILGVRWAIQNNLPLGNSRPFPGSLQRRLSRLRAEYKDRQAAFVSKDPLGNESFVLA
FT                   EIEVQRRSVPFRSPFEHRKPVMHMQTATIVGPAGEEVYTDELNRVKAQMHWDRLGSNNE
FT                   TSSCWMRVILPHAGKGFGGVFVPRIGQEVAVNYLDGDCDRPVVSGVLFHSVNTPHWHSN
FT                   GLLSGFKSQEYSGQGFNQLVFDDSTSQNRAQLFSSTANSYLHIGYLIDHSGNTRGNYLG
FT                   TGFELKTEASGALRAGRGLYVSTYARGGTSSQPLDVKEATQHLIDSSGVIQHRSLAAAD
FT                   GQAETLDDAQDAIKDFAATTQSDAQGSMAGGRTAGGGTGSANAFSQPVMLLASPADMGL
FT                   STQKSLHAAATQHVNLVSGESTYVSVARSWIASIGEKLSFFVQNSGIKLFAGKGKVEVQ
FT                   AQSDNIELTADKTVKVVSTSDSVNVTAQKEITLTAGGASIRIAEGKIFIHAPGLVEVKG
FT                   SPLTFDGPAGDSASAQLAPSKSCAQQFAAAAQAGSALV"
     MGRLPNSLML DAGIEQTNRA LVLETPLGAK VLLPQRAMGE SRVGRDFELT VDVVSRERAL        60
     HLKKLMAQPV TLWVRQADES YLPWHGYVHA TRRLGADGGL TYYQLSFSSW MRFLQYRKDA       120
     RIFQDLTTAD ILTKVFSGHS QARGHFRLDV KDPGAVRSYC TQYETDHNFV HRLMESEGWF       180
     TYVEHAEDGK SHTIVVTDDL FNCKALATQR VPFYRGDRDG QAGTLVEWSG ERTTQSVGYA       240
     FSTADYKRPA RTLQRADRST VDQGDIPQEL EVYEYAGHYS FPVTGESYDR GERAMRIRLE       300
     EMASRSKRFF GVGSVSCMDA GRWFTLEDHP EHDADKPEDR EFAILGVRWA IQNNLPLGNS       360
     RPFPGSLQRR LSRLRAEYKD RQAAFVSKDP LGNESFVLAE IEVQRRSVPF RSPFEHRKPV       420
     MHMQTATIVG PAGEEVYTDE LNRVKAQMHW DRLGSNNETS SCWMRVILPH AGKGFGGVFV       480
     PRIGQEVAVN YLDGDCDRPV VSGVLFHSVN TPHWHSNGLL SGFKSQEYSG QGFNQLVFDD       540
     STSQNRAQLF SSTANSYLHI GYLIDHSGNT RGNYLGTGFE LKTEASGALR AGRGLYVSTY       600
     ARGGTSSQPL DVKEATQHLI DSSGVIQHRS LAAADGQAET LDDAQDAIKD FAATTQSDAQ       660
     GSMAGGRTAG GGTGSANAFS QPVMLLASPA DMGLSTQKSL HAAATQHVNL VSGESTYVSV       720
     ARSWIASIGE KLSFFVQNSG IKLFAGKGKV EVQAQSDNIE LTADKTVKVV STSDSVNVTA       780
     QKEITLTAGG ASIRIAEGKI FIHAPGLVEV KGSPLTFDGP AGDSASAQLA PSKSCAQQFA       840
     AAAQAGSALV                                                              850
//

If you have problems or comments...

PBIL Back to PBIL home page