(data stored in ACNUC1104 zone)

EMBL: CP000959.PE589

CP000959.PE589       Location/Qualifiers
FT   CDS             complement(692655..693065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3779"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3779"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92930"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR013423"
FT                   /db_xref="UniProtKB/TrEMBL:B1K506"
FT                   /protein_id="ACA92930.1"
FT                   /translation="MSVALAELGIRRHPPGSINPRIVEYNNQTNLVGYDDKISWCSSFV
FT                   NWCMAHAGFRGTGSALARSWLEWGKPLERPVYGCIAILTRDDPTSWKGHVGFYLRHDVE
FT                   HVYLFGGNQLEEVRELAYPLHEVIGYRWPATE"
     MSVALAELGI RRHPPGSINP RIVEYNNQTN LVGYDDKISW CSSFVNWCMA HAGFRGTGSA        60
     LARSWLEWGK PLERPVYGCI AILTRDDPTS WKGHVGFYLR HDVEHVYLFG GNQLEEVREL       120
     AYPLHEVIGY RWPATE                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page