(data stored in ACNUC1104 zone)

EMBL: CP000959.PE594

CP000959.PE594       Location/Qualifiers
FT   CDS             complement(697744..699540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3784"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_2378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3784"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92935"
FT                   /db_xref="InterPro:IPR026487"
FT                   /db_xref="UniProtKB/TrEMBL:B1K511"
FT                   /protein_id="ACA92935.1"
FT                   /translation="MAERTAEKRHKKVSLNTFLLKKPAGSASGKFWSEREFLAKPLDQD
FT                   GRPRKIDVDEYSLGDKGKFGTLYVRKPLSESTPEWVGFIAPQISRSGGLEGLKNKSVSA
FT                   LLVTTVKGRQFAVAFGHGRYMLDAECIETRFGIRVALNSISPDKIASIDRQTFEATPRI
FT                   SRTQALRATSVAEYEINEQQDLLRGLVGFTLNEYKDDLGEVLAGMDSLKASVGIDLPKL
FT                   GKFLEVALKRSLAGDYRKTDNGQAGAFAWVDNLESVDRPDILDELDKMLWKLFESDDFS
FT                   TMWLAIPEIVNWEDVTGFCYTRGELESSIHAALDIKDLKKSLRSNATLDTLRHRAIHMV
FT                   LASGVPPRVYSAYKCLYAEVRYNKALYILNAGNWYCVDSSFKNLVDKYFDNTLRRNFDK
FT                   PFVEYEHDGEGKYNEAVAANLPRKYAMLDRKLISFGGKSSKIEVCDLYAASSSRTERSQ
FT                   LIHVKRGRSSATLSHLFAQGLVSSTLLVSEPGFVVEVNKQLVKQNFAKFPAKPIGSRYE
FT                   VVFAIIDGPSGAKLDLPFFSKVNLRVCGRRLQNFGFTVSLMHIPESAKFLAEARKRKAK
FT                   KQAVAKVAAKAAVRRVTRARKS"
     MAERTAEKRH KKVSLNTFLL KKPAGSASGK FWSEREFLAK PLDQDGRPRK IDVDEYSLGD        60
     KGKFGTLYVR KPLSESTPEW VGFIAPQISR SGGLEGLKNK SVSALLVTTV KGRQFAVAFG       120
     HGRYMLDAEC IETRFGIRVA LNSISPDKIA SIDRQTFEAT PRISRTQALR ATSVAEYEIN       180
     EQQDLLRGLV GFTLNEYKDD LGEVLAGMDS LKASVGIDLP KLGKFLEVAL KRSLAGDYRK       240
     TDNGQAGAFA WVDNLESVDR PDILDELDKM LWKLFESDDF STMWLAIPEI VNWEDVTGFC       300
     YTRGELESSI HAALDIKDLK KSLRSNATLD TLRHRAIHMV LASGVPPRVY SAYKCLYAEV       360
     RYNKALYILN AGNWYCVDSS FKNLVDKYFD NTLRRNFDKP FVEYEHDGEG KYNEAVAANL       420
     PRKYAMLDRK LISFGGKSSK IEVCDLYAAS SSRTERSQLI HVKRGRSSAT LSHLFAQGLV       480
     SSTLLVSEPG FVVEVNKQLV KQNFAKFPAK PIGSRYEVVF AIIDGPSGAK LDLPFFSKVN       540
     LRVCGRRLQN FGFTVSLMHI PESAKFLAEA RKRKAKKQAV AKVAAKAAVR RVTRARKS         598
//

If you have problems or comments...

PBIL Back to PBIL home page