(data stored in ACNUC1104 zone)

EMBL: CP000959.PE595

CP000959.PE595       Location/Qualifiers
FT   CDS             complement(700238..702100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3785"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bur:Bcep18194_B2357
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3785"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92936"
FT                   /db_xref="GOA:B1K512"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B1K512"
FT                   /protein_id="ACA92936.1"
FT                   /translation="MHFWRKLSIQNKLILSMTSCLLVFVAISSGLSVRLIGSAVRERVV
FT                   REELPTAVNGIRADVQRQMAGPIAASRILARDAFLLQWEADGEPDAGTRNWIQLAKNVK
FT                   DEQKAASVQWVSVKSGNYYNEAGLQRKVTDKDQWLTSFLSSGKAYDVNMDREVTVGGYM
FT                   MFINSRVELDGVPIGAACMSLSVDALAKGISAYRIGETGFAYLVRPDGAIMMHRDMSLI
FT                   DGKHFLKDERGLPGDASATLLAGKSYAYLSYEGDGGARFIATSFIPELNAYVVVQVPQA
FT                   ELLGPVTRAIRSAALVAAVVGFGVALLVIWLVGRAIAAPIRRAATLLSEIASGQGDLTR
FT                   RMTVESEDEIGQLSDAFNRFVSSLSTLVHRIRAASASIATGSAQIASGNADLSERTEGQ
FT                   SSNLERTASSMEEITAVVRNNTETATTAAKMINGAADTAARGGQVVGEVVTTMEQISDA
FT                   SQRISEIIVMIDSISFQTNILALNAAVEAARAGEQGRGFAVVASEVRNLAQRSAQAAKE
FT                   IKSLIEHSAGTVGAGSRLVSEAGKVMSDVVSQVQGVSAMMSEIAEASLEQSAGIDQIGD
FT                   AVQSLDQMTQQNAALVEESAAAAESLKQQAAELTKLVSAFKVAE"
     MHFWRKLSIQ NKLILSMTSC LLVFVAISSG LSVRLIGSAV RERVVREELP TAVNGIRADV        60
     QRQMAGPIAA SRILARDAFL LQWEADGEPD AGTRNWIQLA KNVKDEQKAA SVQWVSVKSG       120
     NYYNEAGLQR KVTDKDQWLT SFLSSGKAYD VNMDREVTVG GYMMFINSRV ELDGVPIGAA       180
     CMSLSVDALA KGISAYRIGE TGFAYLVRPD GAIMMHRDMS LIDGKHFLKD ERGLPGDASA       240
     TLLAGKSYAY LSYEGDGGAR FIATSFIPEL NAYVVVQVPQ AELLGPVTRA IRSAALVAAV       300
     VGFGVALLVI WLVGRAIAAP IRRAATLLSE IASGQGDLTR RMTVESEDEI GQLSDAFNRF       360
     VSSLSTLVHR IRAASASIAT GSAQIASGNA DLSERTEGQS SNLERTASSM EEITAVVRNN       420
     TETATTAAKM INGAADTAAR GGQVVGEVVT TMEQISDASQ RISEIIVMID SISFQTNILA       480
     LNAAVEAARA GEQGRGFAVV ASEVRNLAQR SAQAAKEIKS LIEHSAGTVG AGSRLVSEAG       540
     KVMSDVVSQV QGVSAMMSEI AEASLEQSAG IDQIGDAVQS LDQMTQQNAA LVEESAAAAE       600
     SLKQQAAELT KLVSAFKVAE                                                   620
//

If you have problems or comments...

PBIL Back to PBIL home page