(data stored in ACNUC1104 zone)

EMBL: CP000959.PE596

CP000959.PE596       Location/Qualifiers
FT   CDS             complement(702272..702943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3786"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   bur:Bcep18194_B2358 outer membrane protein, OmpA/MotB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3786"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92937"
FT                   /db_xref="GOA:B1K513"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B1K513"
FT                   /protein_id="ACA92937.1"
FT                   /translation="MTARTDGASAADRDDDELEGAQSGRWLISYADLITTLMVLFLALY
FT                   VLQLAKYNALDARYQTLARQAGGAATAAVDTAKADPAPPWLALLDSLKSNGRISLVKAP
FT                   HGVEIGIDAKILFNVGDARLLPDSSPVLNQIAQALSAHTTGDILVEGHTDSVPIANAKY
FT                   ESNWELSSARAGSVVRYLSERGVAPHRLAAIGRADTQPLVAGGDAGSRARNRRVTIFVA
FT                   Y"
     MTARTDGASA ADRDDDELEG AQSGRWLISY ADLITTLMVL FLALYVLQLA KYNALDARYQ        60
     TLARQAGGAA TAAVDTAKAD PAPPWLALLD SLKSNGRISL VKAPHGVEIG IDAKILFNVG       120
     DARLLPDSSP VLNQIAQALS AHTTGDILVE GHTDSVPIAN AKYESNWELS SARAGSVVRY       180
     LSERGVAPHR LAAIGRADTQ PLVAGGDAGS RARNRRVTIF VAY                         223
//

If you have problems or comments...

PBIL Back to PBIL home page