(data stored in ACNUC1104 zone)

EMBL: CP000959.PE599

CP000959.PE599       Location/Qualifiers
FT   CDS             complement(705285..705947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3789"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bur:Bcep18194_B2364 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3789"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92940"
FT                   /db_xref="GOA:B1K516"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B1K516"
FT                   /protein_id="ACA92940.1"
FT                   /translation="MESNARTTLTISSRNYSSWSMRGWLLAKLSGLTFETISVPIDATS
FT                   RAELLLLSPSILVPCLTHDGNAVWDTLAIAEYLNEIRPQARLLPDDRHARAHCRSICGE
FT                   MHSGFSALRSALPMNLRGHFPGFRIWSRAQHDIERIVTIWRECLAEYGGPWLFGAEIGI
FT                   ADAMYAPVVTRFLTYDVKLEPDVAEYCMRVLAHPFVAEWIEEAKAEHEDIDELDMEF"
     MESNARTTLT ISSRNYSSWS MRGWLLAKLS GLTFETISVP IDATSRAELL LLSPSILVPC        60
     LTHDGNAVWD TLAIAEYLNE IRPQARLLPD DRHARAHCRS ICGEMHSGFS ALRSALPMNL       120
     RGHFPGFRIW SRAQHDIERI VTIWRECLAE YGGPWLFGAE IGIADAMYAP VVTRFLTYDV       180
     KLEPDVAEYC MRVLAHPFVA EWIEEAKAEH EDIDELDMEF                             220
//

If you have problems or comments...

PBIL Back to PBIL home page