(data stored in ACNUC1104 zone)

EMBL: CP000959.PE66

CP000959.PE66        Location/Qualifiers
FT   CDS             76730..78214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3251"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_B1740 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3251"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92407"
FT                   /db_xref="GOA:B1K8R0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8R0"
FT                   /protein_id="ACA92407.1"
FT                   /translation="MDIAIRIEGRHDLTGQIFRQLRTAIVDGRLEGGARLPSTRDLAKQ
FT                   LGVSRKTTLDAFERLVAEGYLTTRAGDGTFVADGLARVPHAAVTSTPSIVDERPRIDAV
FT                   DVRALWNDLPDALAMPAPQDSPGFDFRGGVTDKTLFPFDAWRRCLHHALRQQARGPGQY
FT                   HDPAGDPQLRGAIARYAGFSRAVACSWDDVLVTQGAQQALDLLARVVVRPGDVVAVEDP
FT                   GYPPARAAFASLGATVIGVPVDAQGLVTERLPDDARLVYVTPSHQFPLGMPMTLERRVA
FT                   LLEWAQRRRAVIIEDDYDGEFRFEGRPVESLKSLDRTGLVAYVGTFSKTIFPELRIGYA
FT                   IPPRALRGALAKAKQIVDWHTCTLTQAALARFMHEGDFARHLKRVQKHYDARRKMLVAH
FT                   LRGALAPWFDAIVPTAGIHLAAHLKPGLDEAALVRAARAQDIGLYGISAFHVGVPVRPG
FT                   LLFGYGGIDALRIDTALAKLAGLLDDGIAGGPPLVT"
     MDIAIRIEGR HDLTGQIFRQ LRTAIVDGRL EGGARLPSTR DLAKQLGVSR KTTLDAFERL        60
     VAEGYLTTRA GDGTFVADGL ARVPHAAVTS TPSIVDERPR IDAVDVRALW NDLPDALAMP       120
     APQDSPGFDF RGGVTDKTLF PFDAWRRCLH HALRQQARGP GQYHDPAGDP QLRGAIARYA       180
     GFSRAVACSW DDVLVTQGAQ QALDLLARVV VRPGDVVAVE DPGYPPARAA FASLGATVIG       240
     VPVDAQGLVT ERLPDDARLV YVTPSHQFPL GMPMTLERRV ALLEWAQRRR AVIIEDDYDG       300
     EFRFEGRPVE SLKSLDRTGL VAYVGTFSKT IFPELRIGYA IPPRALRGAL AKAKQIVDWH       360
     TCTLTQAALA RFMHEGDFAR HLKRVQKHYD ARRKMLVAHL RGALAPWFDA IVPTAGIHLA       420
     AHLKPGLDEA ALVRAARAQD IGLYGISAFH VGVPVRPGLL FGYGGIDALR IDTALAKLAG       480
     LLDDGIAGGP PLVT                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page