(data stored in ACNUC1104 zone)

EMBL: CP000959.PE72

CP000959.PE72        Location/Qualifiers
FT   CDS             complement(83644..85269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3257"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   bur:Bcep18194_B1751 rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3257"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92413"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8R6"
FT                   /protein_id="ACA92413.1"
FT                   /translation="MTQSADSISRFPVASYQDVRARLLARDEIALIDVREEDPYAQGHP
FT                   LWAANFPLSKLELDAWTRIPRRDTPIVVFGEAGGEDLAPRAAATLARLGYTDVRLLDGG
FT                   LAGWVAAGGELFIDVNVPSKSFGEWVEAERHTPSLSAQEVQALIDAKADVVIVDARRFD
FT                   EYQTMNIPTSTSVPGAELVLRVRALAPDPRTQVIVNCAGRTRSIIGTQSLVNAGLPNPV
FT                   AALRNGTIGWTLAGQTLERGAARRFPDEIDATQRAEARQAARAVAERAGVPRIAFEDVA
FT                   ALDEPGRTLYRFDVRTPEEYEAGHLPSFLSTPGGQLVQETDHHAAVRGARIVLADDDGV
FT                   RADMTASWLAQMGWDVRVVEPGGTAAFSERGHPPRDVPATPPAADVSPATLAGWLKEAA
FT                   PGELAIVDVTASANYVKRHIPGAWFAVRAQLRDALAAIPPAKRYVFTCGSSLLARFAAD
FT                   DARALLPASAEIRVLTGGTAAWIDAGLPLENGETHLASPRVDRYRRPYEGTDNAAAAMQ
FT                   AYLDWEYGLVDQLKRDGTHHFNVI"
     MTQSADSISR FPVASYQDVR ARLLARDEIA LIDVREEDPY AQGHPLWAAN FPLSKLELDA        60
     WTRIPRRDTP IVVFGEAGGE DLAPRAAATL ARLGYTDVRL LDGGLAGWVA AGGELFIDVN       120
     VPSKSFGEWV EAERHTPSLS AQEVQALIDA KADVVIVDAR RFDEYQTMNI PTSTSVPGAE       180
     LVLRVRALAP DPRTQVIVNC AGRTRSIIGT QSLVNAGLPN PVAALRNGTI GWTLAGQTLE       240
     RGAARRFPDE IDATQRAEAR QAARAVAERA GVPRIAFEDV AALDEPGRTL YRFDVRTPEE       300
     YEAGHLPSFL STPGGQLVQE TDHHAAVRGA RIVLADDDGV RADMTASWLA QMGWDVRVVE       360
     PGGTAAFSER GHPPRDVPAT PPAADVSPAT LAGWLKEAAP GELAIVDVTA SANYVKRHIP       420
     GAWFAVRAQL RDALAAIPPA KRYVFTCGSS LLARFAADDA RALLPASAEI RVLTGGTAAW       480
     IDAGLPLENG ETHLASPRVD RYRRPYEGTD NAAAAMQAYL DWEYGLVDQL KRDGTHHFNV       540
     I                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page