(data stored in ACNUC1104 zone)

EMBL: CP000959.PE74

CP000959.PE74        Location/Qualifiers
FT   CDS             86016..86939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3259"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B1753
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92415"
FT                   /db_xref="GOA:B1K8R8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8R8"
FT                   /protein_id="ACA92415.1"
FT                   /translation="MKISDIDAFAAVVRCQTLSQAAAELGMTQPAITRRVQNLEEALGV
FT                   TLLDRNTKPPRPTDIGRQVFEQCRAILREVDALRELTAGQQPPAGEFRIGLTQGLGELM
FT                   LPALIGDLAAQWPALATQVTTAWGGLLVERIARRELDAALVFLAREMVLPAQVEGVRLL
FT                   DTRLVAVGRKGDWPRRSYRLADCHARGWVLNPDGCGFRAGLRRALDAQGLPMPVTLDAY
FT                   GRDLQLQSVANGFGLGLMPLPLVEGSPLRDALDIVPLADFRPQIDLWLLRRHDAARFDA
FT                   PLAAIAAHARAAFALPERSHDKAKAA"
     MKISDIDAFA AVVRCQTLSQ AAAELGMTQP AITRRVQNLE EALGVTLLDR NTKPPRPTDI        60
     GRQVFEQCRA ILREVDALRE LTAGQQPPAG EFRIGLTQGL GELMLPALIG DLAAQWPALA       120
     TQVTTAWGGL LVERIARREL DAALVFLARE MVLPAQVEGV RLLDTRLVAV GRKGDWPRRS       180
     YRLADCHARG WVLNPDGCGF RAGLRRALDA QGLPMPVTLD AYGRDLQLQS VANGFGLGLM       240
     PLPLVEGSPL RDALDIVPLA DFRPQIDLWL LRRHDAARFD APLAAIAAHA RAAFALPERS       300
     HDKAKAA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page