(data stored in ACNUC1104 zone)

EMBL: CP000959.PE75

CP000959.PE75        Location/Qualifiers
FT   CDS             complement(87028..88407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3260"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   bur:Bcep18194_B1754 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3260"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92416"
FT                   /db_xref="GOA:B1K8R9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8R9"
FT                   /protein_id="ACA92416.1"
FT                   /translation="MSASLAASSPPPQPALRLLPADAAGTADIADADADADAADATNDA
FT                   RLAALLERLAPELAADAARNDVDGRFPHENFARLHRAGLIAQVVPREHGGAGATLAQAS
FT                   RIVAAVARADPATALVLTMTYLQHRALGRVDNRWPAQVRRAVFDSAVAHGALINALRVE
FT                   PALGSPSRGGLPATIARRDGDGWRLSGHKLYSTGIPALRWLAVWARTDEPAPRVGVFLV
FT                   PRDPEADGDRIRVIESWNHLGLRASGSHEVVFDDVPLPAEYAVDVRAPDAWVVSAATHA
FT                   DADAQADQQAWMVALLGSLYDAVARASRDWLVEFATTRAPSGLGAPLATLPRVQEAVGE
FT                   IESWLHTNRVLLDDHIARTDAGNAPSVTTSGLVKRTVTEQAIRTVEQALKLSGNHGLSR
FT                   TNPLERHYRDVLCSRVHTPQDDAIAVAAGRAVLDAAPRGQTHAAADAASRNGGERGRHD
FT                   A"
     MSASLAASSP PPQPALRLLP ADAAGTADIA DADADADAAD ATNDARLAAL LERLAPELAA        60
     DAARNDVDGR FPHENFARLH RAGLIAQVVP REHGGAGATL AQASRIVAAV ARADPATALV       120
     LTMTYLQHRA LGRVDNRWPA QVRRAVFDSA VAHGALINAL RVEPALGSPS RGGLPATIAR       180
     RDGDGWRLSG HKLYSTGIPA LRWLAVWART DEPAPRVGVF LVPRDPEADG DRIRVIESWN       240
     HLGLRASGSH EVVFDDVPLP AEYAVDVRAP DAWVVSAATH ADADAQADQQ AWMVALLGSL       300
     YDAVARASRD WLVEFATTRA PSGLGAPLAT LPRVQEAVGE IESWLHTNRV LLDDHIARTD       360
     AGNAPSVTTS GLVKRTVTEQ AIRTVEQALK LSGNHGLSRT NPLERHYRDV LCSRVHTPQD       420
     DAIAVAAGRA VLDAAPRGQT HAAADAASRN GGERGRHDA                              459
//

If you have problems or comments...

PBIL Back to PBIL home page