(data stored in ACNUC1104 zone)

EMBL: CP000959.PE76

CP000959.PE76        Location/Qualifiers
FT   CDS             88654..89739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3261"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG:
FT                   bur:Bcep18194_B1755 alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3261"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92417"
FT                   /db_xref="GOA:B1K8S0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8S0"
FT                   /protein_id="ACA92417.1"
FT                   /translation="MSVEFIGMIQSQKQSEIHPASGPVVDPDYVRDFARAHETAGFDRI
FT                   LVPHHSTGPSATLTIAFAAAATERIHFMLAHRPGFTAPTLAARQIATLDQFSRGRLAVH
FT                   FISGGSDSEQQRDGDFLDHDARYARTDEYLGILRRIWTEPQPFDHDGAHYRFKQGFSEV
FT                   KPFQQPHVPIYFGGASEAALAVAGKHADVYALWGESLDQVRDLTTRVRAEAAKHGRQVR
FT                   FSVSFRPILAATEDEAWARAHRILDETRRLREAAGLGAGGPQQSEGARRLLAAAERGSR
FT                   VDKRLWTEIAKLTGARSNSTALVGTPEQVADALLDYYDLGVTTFLIRGFDPLEDAIDYG
FT                   RELIPRVRGAVAARDAARRAA"
     MSVEFIGMIQ SQKQSEIHPA SGPVVDPDYV RDFARAHETA GFDRILVPHH STGPSATLTI        60
     AFAAAATERI HFMLAHRPGF TAPTLAARQI ATLDQFSRGR LAVHFISGGS DSEQQRDGDF       120
     LDHDARYART DEYLGILRRI WTEPQPFDHD GAHYRFKQGF SEVKPFQQPH VPIYFGGASE       180
     AALAVAGKHA DVYALWGESL DQVRDLTTRV RAEAAKHGRQ VRFSVSFRPI LAATEDEAWA       240
     RAHRILDETR RLREAAGLGA GGPQQSEGAR RLLAAAERGS RVDKRLWTEI AKLTGARSNS       300
     TALVGTPEQV ADALLDYYDL GVTTFLIRGF DPLEDAIDYG RELIPRVRGA VAARDAARRA       360
     A                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page