(data stored in ACNUC1104 zone)

EMBL: CP000959.PE83

CP000959.PE83        Location/Qualifiers
FT   CDS             95912..96778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3268"
FT                   /product="MOSC domain protein beta barrel domain protein"
FT                   /note="PFAM: MOSC domain containing protein; MOSC domain
FT                   protein beta barrel domain protein; KEGG:
FT                   bur:Bcep18194_B1762 uncharacterized Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3268"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92424"
FT                   /db_xref="GOA:B1K8S7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8S7"
FT                   /protein_id="ACA92424.1"
FT                   /translation="MPAITELFVYPIKSCAGIALTRAQLLETGLAYDRHWLITDPHGQM
FT                   LTQRTHPRLALIRPTLDNDALVLNAPGMPALRTLLDGDATPATPKMAATVWRDTVDAID
FT                   TGAETAAWLTEFLGVPAKLARFGPAARRGCNRKWTSEIDTHTQFADGYPLLVIGQSSLD
FT                   DLNARLAAKGAPAIPMNRFRPNIVVSELDAYEEDFVEHLDVDGDTPARLRLVKLCTRCP
FT                   MPTIDQATGAPDPAWPHEPTDTMQTYRANPNYDGALTFGINAIVVEGAGAWLEVGQPVE
FT                   AEIGFGD"
     MPAITELFVY PIKSCAGIAL TRAQLLETGL AYDRHWLITD PHGQMLTQRT HPRLALIRPT        60
     LDNDALVLNA PGMPALRTLL DGDATPATPK MAATVWRDTV DAIDTGAETA AWLTEFLGVP       120
     AKLARFGPAA RRGCNRKWTS EIDTHTQFAD GYPLLVIGQS SLDDLNARLA AKGAPAIPMN       180
     RFRPNIVVSE LDAYEEDFVE HLDVDGDTPA RLRLVKLCTR CPMPTIDQAT GAPDPAWPHE       240
     PTDTMQTYRA NPNYDGALTF GINAIVVEGA GAWLEVGQPV EAEIGFGD                    288
//

If you have problems or comments...

PBIL Back to PBIL home page