(data stored in ACNUC1104 zone)

EMBL: CP000959.PE85

CP000959.PE85        Location/Qualifiers
FT   CDS             complement(98255..98929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3270"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bur:Bcep18194_B1764 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92426"
FT                   /db_xref="GOA:B1K8S9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8S9"
FT                   /protein_id="ACA92426.1"
FT                   /translation="MRVLLVEDNPNLAQSLNDALSAARFAVDHMADGEAADHVLRTQDY
FT                   ALVILDLGLPKLDGLEVLRRLRARRNPVPVLILTAHGSVEDRVKGLDLGADDYLAKPFE
FT                   LTELEARARALIRRSLGHEHSRVECGPLSYDSIDRSFHLAGEPLSLTPRERSVLEVLIL
FT                   RNGRAINKDTLSEKIFGLDESVNADAIEIYVYRLRKKLENTGVAIVTLRGLGYLLEAKA
FT                   EE"
     MRVLLVEDNP NLAQSLNDAL SAARFAVDHM ADGEAADHVL RTQDYALVIL DLGLPKLDGL        60
     EVLRRLRARR NPVPVLILTA HGSVEDRVKG LDLGADDYLA KPFELTELEA RARALIRRSL       120
     GHEHSRVECG PLSYDSIDRS FHLAGEPLSL TPRERSVLEV LILRNGRAIN KDTLSEKIFG       180
     LDESVNADAI EIYVYRLRKK LENTGVAIVT LRGLGYLLEA KAEE                        224
//

If you have problems or comments...

PBIL Back to PBIL home page