(data stored in ACNUC1104 zone)

EMBL: CP000959.PE87

CP000959.PE87        Location/Qualifiers
FT   CDS             100373..101854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3272"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_B1766 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92428"
FT                   /db_xref="GOA:B1K8T1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8T1"
FT                   /protein_id="ACA92428.1"
FT                   /translation="MSRGKAAIPLDLPRPAGLSGGSPHSKQECIADTIRDAILKRLLPG
FT                   DSPLPSSRTLAARWDIARGTVEAAYDVLCAEGYIARTQGSGTRVCAVVPDSYLRAAARS
FT                   RDGSPLPATLASPASTAPAEPEHGVRPGVPFVARLADPGLLPIQQWKKALGASLLAATA
FT                   DDLGATPAQGVESLRAEIAAYLREYRGIPCEAGDIVITTGIRHAIDLVARTLLAPGSTV
FT                   LMEDPGYASAWQIFTIAGATVIDVPVDREGIDTASLNRHPDARAAYVTPAHQAPLGVTM
FT                   SVSRRLELLDWAQRNRTWIIEDDYDGEFSYQTAPLPALKSLDACDRVIYCGSFNKTLFS
FT                   GLRIGFMIVPAELRPALSAVWHATARSVGVAPQLALARFIGQGDFAKHLRAARHAYRQR
FT                   RDIVLDQLEKHARGRYSVTGEHAGFHFVLWLPPGIDDATYVAQARAAGIELQPVRGFCR
FT                   SARREAGVVVGYAALTAAHARHGGRLLGQLLATSA"
     MSRGKAAIPL DLPRPAGLSG GSPHSKQECI ADTIRDAILK RLLPGDSPLP SSRTLAARWD        60
     IARGTVEAAY DVLCAEGYIA RTQGSGTRVC AVVPDSYLRA AARSRDGSPL PATLASPAST       120
     APAEPEHGVR PGVPFVARLA DPGLLPIQQW KKALGASLLA ATADDLGATP AQGVESLRAE       180
     IAAYLREYRG IPCEAGDIVI TTGIRHAIDL VARTLLAPGS TVLMEDPGYA SAWQIFTIAG       240
     ATVIDVPVDR EGIDTASLNR HPDARAAYVT PAHQAPLGVT MSVSRRLELL DWAQRNRTWI       300
     IEDDYDGEFS YQTAPLPALK SLDACDRVIY CGSFNKTLFS GLRIGFMIVP AELRPALSAV       360
     WHATARSVGV APQLALARFI GQGDFAKHLR AARHAYRQRR DIVLDQLEKH ARGRYSVTGE       420
     HAGFHFVLWL PPGIDDATYV AQARAAGIEL QPVRGFCRSA RREAGVVVGY AALTAAHARH       480
     GGRLLGQLLA TSA                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page