(data stored in ACNUC1104 zone)

EMBL: CP000959.PE89

CP000959.PE89        Location/Qualifiers
FT   CDS             103257..105029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3274"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B1768 ABC
FT                   Fe3+ siderophore transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3274"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92430"
FT                   /db_xref="GOA:B1K8T3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8T3"
FT                   /protein_id="ACA92430.1"
FT                   /translation="MLSTSTRGTAPAVPPATGPRDAIPALPVSSLQPLAGMLRWIVVAV
FT                   LTVAVALPLGFILFQSLLSAPFFDANKTLGIEGFRFIFSDPDFWSAVKNSFIIAGGMLF
FT                   ISIPLGGILAFLMVRTDLPGRRWLEPLLLTPVFVSPMVLAFGYVVAAGPVGFYSVWFKE
FT                   LFGVQNVPWNVYSIFAITVIVGLTHVPHVYLYSSAALRNLGSDVEEAARVTGARPFRVA
FT                   LDVSLPMTMPALLFAGVLVFFLGFEVFGLPLVLGDPEGHLVLATYLYKLTNKLGVPSYH
FT                   LMAAVAVCIVAITFPLVLLQRRLLKTASRFVTVKGKAGRATVLPLGVWRWVALAIVALW
FT                   LMLTVIVPISGIVLRAFVTNWGEGVALAEVLTLSNFIELFEQDNLVRAIVNTLGIGVIG
FT                   GALAIGFYSLVAFAGHRRPDWATKLLDYLVLLPRAVPGLLAGLAFLWIFLFVPGLRELK
FT                   NSMWSIWIAYTVVWLAYGMRLIQSALLQVGPELEEAGRSVGATRSRVSLDVTLPLVRFG
FT                   LLAAWLLIFMIFEREYSTAVYLLSPGTEVIGALLVSLWATGAVDQVAALSVINIAMVGA
FT                   GLGVALRFGVKLHG"
     MLSTSTRGTA PAVPPATGPR DAIPALPVSS LQPLAGMLRW IVVAVLTVAV ALPLGFILFQ        60
     SLLSAPFFDA NKTLGIEGFR FIFSDPDFWS AVKNSFIIAG GMLFISIPLG GILAFLMVRT       120
     DLPGRRWLEP LLLTPVFVSP MVLAFGYVVA AGPVGFYSVW FKELFGVQNV PWNVYSIFAI       180
     TVIVGLTHVP HVYLYSSAAL RNLGSDVEEA ARVTGARPFR VALDVSLPMT MPALLFAGVL       240
     VFFLGFEVFG LPLVLGDPEG HLVLATYLYK LTNKLGVPSY HLMAAVAVCI VAITFPLVLL       300
     QRRLLKTASR FVTVKGKAGR ATVLPLGVWR WVALAIVALW LMLTVIVPIS GIVLRAFVTN       360
     WGEGVALAEV LTLSNFIELF EQDNLVRAIV NTLGIGVIGG ALAIGFYSLV AFAGHRRPDW       420
     ATKLLDYLVL LPRAVPGLLA GLAFLWIFLF VPGLRELKNS MWSIWIAYTV VWLAYGMRLI       480
     QSALLQVGPE LEEAGRSVGA TRSRVSLDVT LPLVRFGLLA AWLLIFMIFE REYSTAVYLL       540
     SPGTEVIGAL LVSLWATGAV DQVAALSVIN IAMVGAGLGV ALRFGVKLHG                  590
//

If you have problems or comments...

PBIL Back to PBIL home page