(data stored in ACNUC1104 zone)

EMBL: CP000959.PE90

CP000959.PE90        Location/Qualifiers
FT   CDS             105022..106089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3275"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B1769 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92431"
FT                   /db_xref="GOA:B1K8T4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8T4"
FT                   /protein_id="ACA92431.1"
FT                   /translation="MDKLIVDDLHLSYGANPILKGVSFELKAGEVVCLLGASGSGKTTL
FT                   LRAVAGLEQPSNGGIQLDDRVFFDGARRVDLPVEQRSLGLVFQSYALWPHRTVADNVGY
FT                   GLKLRRVAPAEQKRRVQTALDQLGLGHLAERFPHQLSGGQQQRVAIARALVYNPPVILL
FT                   DEPLSNLDAKLREEARAWLRELIVSLGLSALCVTHDQTEAMAMSDRILLLRNGRIEQEG
FT                   TPAELYGAPRSLYTAEFMGSNNRIDARVAAIDGECVTLAGDGWQLQALARDTLAPGQDA
FT                   QAVIRLERVQVTDGPGANRLQADLVTSMYLGDRWEYLFHCGEMRLRAFGHVPRAAGKHW
FT                   IEFPTNDCWAFAKAG"
     MDKLIVDDLH LSYGANPILK GVSFELKAGE VVCLLGASGS GKTTLLRAVA GLEQPSNGGI        60
     QLDDRVFFDG ARRVDLPVEQ RSLGLVFQSY ALWPHRTVAD NVGYGLKLRR VAPAEQKRRV       120
     QTALDQLGLG HLAERFPHQL SGGQQQRVAI ARALVYNPPV ILLDEPLSNL DAKLREEARA       180
     WLRELIVSLG LSALCVTHDQ TEAMAMSDRI LLLRNGRIEQ EGTPAELYGA PRSLYTAEFM       240
     GSNNRIDARV AAIDGECVTL AGDGWQLQAL ARDTLAPGQD AQAVIRLERV QVTDGPGANR       300
     LQADLVTSMY LGDRWEYLFH CGEMRLRAFG HVPRAAGKHW IEFPTNDCWA FAKAG            355
//

If you have problems or comments...

PBIL Back to PBIL home page