(data stored in ACNUC1104 zone)

EMBL: CP000959.PE92

CP000959.PE92        Location/Qualifiers
FT   CDS             complement(107477..108439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3277"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bur:Bcep18194_B1771 zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92433"
FT                   /db_xref="GOA:B1K8T6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8T6"
FT                   /protein_id="ACA92433.1"
FT                   /translation="MKAAVVEGAGQRPVYTEFEPPGAMPGHSLIDVTASALSRIAQGRA
FT                   AGTHYSSVGGYPFVVGVDGVGRLDDGRRVYFFGAPAPFGAMAERTIAPDTQCVPLPDAL
FT                   DDVTAAAIAIPGMSSWAALTERARFVAGETVLVNGATGTSGRLAVRIAKHLGAAKVIAT
FT                   GRNAAALQALLSAGADAVVSLQQDDVHLARALEPHFRVGVDVVLDYLWGASAQTLLVAA
FT                   AKAPPGGQRVRFVEIGSISGADVLLPGAVLRATAIELMGSGLGSVPLPRLLASVHGVFE
FT                   AAGDAGLTIDTRTVPLSAVGEHWGDASSVVRPVFTMRGE"
     MKAAVVEGAG QRPVYTEFEP PGAMPGHSLI DVTASALSRI AQGRAAGTHY SSVGGYPFVV        60
     GVDGVGRLDD GRRVYFFGAP APFGAMAERT IAPDTQCVPL PDALDDVTAA AIAIPGMSSW       120
     AALTERARFV AGETVLVNGA TGTSGRLAVR IAKHLGAAKV IATGRNAAAL QALLSAGADA       180
     VVSLQQDDVH LARALEPHFR VGVDVVLDYL WGASAQTLLV AAAKAPPGGQ RVRFVEIGSI       240
     SGADVLLPGA VLRATAIELM GSGLGSVPLP RLLASVHGVF EAAGDAGLTI DTRTVPLSAV       300
     GEHWGDASSV VRPVFTMRGE                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page