(data stored in ACNUC1104 zone)

EMBL: CP000959.PE98

CP000959.PE98        Location/Qualifiers
FT   CDS             complement(111766..112614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3283"
FT                   /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
FT                   /EC_number="1.13.11.15"
FT                   /note="KEGG: bur:Bcep18194_B1780 3,4-dihydroxyphenylacetate
FT                   2,3-dioxygenase HpaD_Fe; TIGRFAM:
FT                   3,4-dihydroxyphenylacetate 2,3-dioxygenase; PFAM: Extradiol
FT                   ring-cleavage dioxygenase class III protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3283"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92439"
FT                   /db_xref="GOA:B1K8U2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011984"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8U2"
FT                   /protein_id="ACA92439.1"
FT                   /translation="MGKLSLAAKITHVPSMYLSELPGKHHGCREAAIRGHQLIGERCRA
FT                   LGVDTIVVSDVHWLVNAGYHVNCNARFAGTYTSNELPHFIRDMQYAYPGNPALGRLIAE
FT                   TATERGVATRAHEIDSLELEYGTLVPMRYMNGDQHFKVVSIAGWCMWHQLDESRRFGEA
FT                   LLEAIEKSDSNVAFLASGSLSHRFNDNGSPEESIHQISREFFRQVDLRVVELWKQGDFK
FT                   TFCAMLPEYNTHCHGEGGMHDTAMLLGLLGWDRYDKPVEIVTDYFASSGTGQINAIFPL
FT                   P"
     MGKLSLAAKI THVPSMYLSE LPGKHHGCRE AAIRGHQLIG ERCRALGVDT IVVSDVHWLV        60
     NAGYHVNCNA RFAGTYTSNE LPHFIRDMQY AYPGNPALGR LIAETATERG VATRAHEIDS       120
     LELEYGTLVP MRYMNGDQHF KVVSIAGWCM WHQLDESRRF GEALLEAIEK SDSNVAFLAS       180
     GSLSHRFNDN GSPEESIHQI SREFFRQVDL RVVELWKQGD FKTFCAMLPE YNTHCHGEGG       240
     MHDTAMLLGL LGWDRYDKPV EIVTDYFASS GTGQINAIFP LP                          282
//

If you have problems or comments...

PBIL Back to PBIL home page