(data stored in ACNUC7421 zone)

EMBL: CP001022.PE10

CP001022.PE10        Location/Qualifiers
FT   CDS             18784..19674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0010"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; thiazole biosynthesis
FT                   family protein; KEGG: bcl:ABC0451 pyridoxine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59498"
FT                   /db_xref="GOA:B1YGC1"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC1"
FT                   /protein_id="ACB59498.1"
FT                   /translation="MMERQQGSDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVM
FT                   ALERVPSDIRRDGGVARMADPLITEEVLQAVSIPVMAKCRIGHIVEARVLESLGVDFID
FT                   ESEVLTPADEEYHLLKSSFTVPFVCGARDLGEAARRIAEGAAMIRTKGEPGTGNVVEAV
FT                   RHMRKIQAQLHQILHSQPDELMTRAKEWGASYEVLQQIQTTGRLPVVNFAAGGIATPAD
FT                   AALMMHLGAEGVFVGSGIFKSEHPERVAKAIVEAVTYKDDFERIAHLSKGLGTAMKGID
FT                   VTSMPFEERMAPRGW"
     MMERQQGSDR VKRGMAEMQK GGVIMDVVNA EQAKIAEAAG AVAVMALERV PSDIRRDGGV        60
     ARMADPLITE EVLQAVSIPV MAKCRIGHIV EARVLESLGV DFIDESEVLT PADEEYHLLK       120
     SSFTVPFVCG ARDLGEAARR IAEGAAMIRT KGEPGTGNVV EAVRHMRKIQ AQLHQILHSQ       180
     PDELMTRAKE WGASYEVLQQ IQTTGRLPVV NFAAGGIATP ADAALMMHLG AEGVFVGSGI       240
     FKSEHPERVA KAIVEAVTYK DDFERIAHLS KGLGTAMKGI DVTSMPFEER MAPRGW           296
//

If you have problems or comments...

PBIL Back to PBIL home page