(data stored in ACNUC7421 zone)

EMBL: CP001022.PE101

CP001022.PE101       Location/Qualifiers
FT   CDS             128223..128879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0102"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: gka:GK0112 30S ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59589"
FT                   /db_xref="GOA:B1YGV6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV6"
FT                   /protein_id="ACB59589.1"
FT                   /translation="MGQKINPTGLRVGIIKDWESRWFADKDYADLLHEDYVVREYIEKR
FT                   LKDASVSKVEIERAANRLNISLHTAKPGMVIGKGGSEIETLRTDITNLAKGKRVHVNVV
FT                   EVKNPDAVAKLVAENIARQLEGRVSFRRAMKQSIQRSMRSGIKGIKTEVSGRLGGADIA
FT                   RSEKYSEGTVPLHTLRADIDYGTAEADTTYGKIGVKVWLHHGEVLPTKKAASNEQ"
     MGQKINPTGL RVGIIKDWES RWFADKDYAD LLHEDYVVRE YIEKRLKDAS VSKVEIERAA        60
     NRLNISLHTA KPGMVIGKGG SEIETLRTDI TNLAKGKRVH VNVVEVKNPD AVAKLVAENI       120
     ARQLEGRVSF RRAMKQSIQR SMRSGIKGIK TEVSGRLGGA DIARSEKYSE GTVPLHTLRA       180
     DIDYGTAEAD TTYGKIGVKV WLHHGEVLPT KKAASNEQ                               218
//

If you have problems or comments...

PBIL Back to PBIL home page