(data stored in ACNUC7421 zone)

EMBL: CP001022.PE103

CP001022.PE103       Location/Qualifiers
FT   CDS             129337..129540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0104"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: bcl:ABC0158 50S
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59591"
FT                   /db_xref="GOA:B1YGV8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV8"
FT                   /protein_id="ACB59591.1"
FT                   /translation="MKATDLRQQTTEELNGKVGSWKEELFNLRFQLATGQLENPARIRE
FT                   VRKSIARAKTVLRERELGINNA"
     MKATDLRQQT TEELNGKVGS WKEELFNLRF QLATGQLENP ARIREVRKSI ARAKTVLRER        60
     ELGINNA                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page