(data stored in ACNUC7421 zone)

EMBL: CP001022.PE105

CP001022.PE105       Location/Qualifiers
FT   CDS             129884..130252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0106"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: oih:OB0129 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59593"
FT                   /db_xref="GOA:B1YGW0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW0"
FT                   /protein_id="ACB59593.1"
FT                   /translation="MIQQESRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGEVVRAVVVRTKRGVRRKDGSYIRFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELREKDFMKIVSLAPEVL"
     MIQQESRLKV ADNSGAREVL TIKVLGGSGR KTANIGDVIV CTVKQATPGG VVKKGEVVRA        60
     VVVRTKRGVR RKDGSYIRFD ENAAVIIKDD KSPRGTRIFG PVARELREKD FMKIVSLAPE       120
     VL                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page