(data stored in ACNUC7421 zone)

EMBL: CP001022.PE110

CP001022.PE110       Location/Qualifiers
FT   CDS             131915..132451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0111"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: gka:GK0121 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59598"
FT                   /db_xref="GOA:B1YGW5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW5"
FT                   /protein_id="ACB59598.1"
FT                   /translation="MSRIGKKPVVIPAGVTVTVENSTVTVKGPKGELTREFNPTMAINV
FT                   EGNELTVTRPNDEKANRTIHGTTRALIANMVEGVNNGFAKTLDIQGVGYRAQKQGNKIV
FT                   LNLGYSHPIEYTPEQGIEVEVPTNTQIIVRGISKERVGHVAALIRSYRQPEPYKGKGIR
FT                   YSDEVVRRKEGKTGK"
     MSRIGKKPVV IPAGVTVTVE NSTVTVKGPK GELTREFNPT MAINVEGNEL TVTRPNDEKA        60
     NRTIHGTTRA LIANMVEGVN NGFAKTLDIQ GVGYRAQKQG NKIVLNLGYS HPIEYTPEQG       120
     IEVEVPTNTQ IIVRGISKER VGHVAALIRS YRQPEPYKGK GIRYSDEVVR RKEGKTGK         178
//

If you have problems or comments...

PBIL Back to PBIL home page