(data stored in ACNUC7421 zone)

EMBL: CP001022.PE111

CP001022.PE111       Location/Qualifiers
FT   CDS             132489..132839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0112"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: bpu:BPUM_0118 ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59599"
FT                   /db_xref="GOA:B1YGW6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW6"
FT                   /protein_id="ACB59599.1"
FT                   /translation="MISKANKNATRKKRHGRVRRTIIGTAARPRLNVFRSNKNIYVQVI
FT                   DDATHATLASASSLDLEKGNTTDAASAVGKLAAERALEKGIETVVFDRGGYLYHGRIKA
FT                   VAEAAREAGLKF"
     MISKANKNAT RKKRHGRVRR TIIGTAARPR LNVFRSNKNI YVQVIDDATH ATLASASSLD        60
     LEKGNTTDAA SAVGKLAAER ALEKGIETVV FDRGGYLYHG RIKAVAEAAR EAGLKF           116
//

If you have problems or comments...

PBIL Back to PBIL home page