(data stored in ACNUC7421 zone)

EMBL: CP001022.PE115

CP001022.PE115       Location/Qualifiers
FT   CDS             134043..135332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0116"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: bha:BH0154 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59603"
FT                   /db_xref="GOA:B1YGX0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGX0"
FT                   /protein_id="ACB59603.1"
FT                   /translation="MFQAISNMWRVADIRRRILFTLALIIVFRIGAHIPVPMVNTEVFK
FT                   IDQNGILGFLNSFGGNALQNFSLFAMGIMPYITASIVVQLLQMDVVPKFAEWAKQGEAG
FT                   RKKLATVTRYGTIVLGLVQAFGIALGFNRIYPGLVDEQYGTWTYVMIALVLTAGTAFLM
FT                   FLGELITEKGIGNGISMIIFAGIVAGFPNAFRQIYETKLQNAGDALFVNVLYIVLLLLI
FT                   IIAVIVGVIYVQQAARKIPIQYAKRTVNRAPVGGQSTHLPIKLNAAGVIPVIFAVSFMV
FT                   TPPTVASFFASPENATKIRDIFDYTSPIGMSIYVALIIAFSYFYTFVQVNPEQMAENLQ
FT                   KQGGYIPGIRPGKQTEQYITKILYRLTFFGSLFLAVIAVTPTFFIKFAGLPNSVQIGGT
FT                   SLLIVIGVGLETMKQIESQLVKRHYKGFIR"
     MFQAISNMWR VADIRRRILF TLALIIVFRI GAHIPVPMVN TEVFKIDQNG ILGFLNSFGG        60
     NALQNFSLFA MGIMPYITAS IVVQLLQMDV VPKFAEWAKQ GEAGRKKLAT VTRYGTIVLG       120
     LVQAFGIALG FNRIYPGLVD EQYGTWTYVM IALVLTAGTA FLMFLGELIT EKGIGNGISM       180
     IIFAGIVAGF PNAFRQIYET KLQNAGDALF VNVLYIVLLL LIIIAVIVGV IYVQQAARKI       240
     PIQYAKRTVN RAPVGGQSTH LPIKLNAAGV IPVIFAVSFM VTPPTVASFF ASPENATKIR       300
     DIFDYTSPIG MSIYVALIIA FSYFYTFVQV NPEQMAENLQ KQGGYIPGIR PGKQTEQYIT       360
     KILYRLTFFG SLFLAVIAVT PTFFIKFAGL PNSVQIGGTS LLIVIGVGLE TMKQIESQLV       420
     KRHYKGFIR                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page