(data stored in ACNUC7421 zone)

EMBL: CP001022.PE121

CP001022.PE121       Location/Qualifiers
FT   CDS             137723..138118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0122"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: bpu:BPUM_0129
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59609"
FT                   /db_xref="GOA:B1YGX6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGX6"
FT                   /protein_id="ACB59609.1"
FT                   /translation="MAKRKQNVRSKRKVKKNIESGIVHIRSTFNNTIVTITDMQGNAIS
FT                   WATAGNMGFKGSRKSTPFAAQLASETAAKTAMDNGMRTVEVNVKGPGAGREAAIRALQA
FT                   IGLEVTAIRDVTPVPHNGCRPPKRRRV"
     MAKRKQNVRS KRKVKKNIES GIVHIRSTFN NTIVTITDMQ GNAISWATAG NMGFKGSRKS        60
     TPFAAQLASE TAAKTAMDNG MRTVEVNVKG PGAGREAAIR ALQAIGLEVT AIRDVTPVPH       120
     NGCRPPKRRR V                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page