(data stored in ACNUC7421 zone)

EMBL: CP001022.PE122

CP001022.PE122       Location/Qualifiers
FT   CDS             138256..139200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0123"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: bsu:BSU01430 DNA-directed RNA polymerase
FT                   subunit alpha; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase alpha subunit domain protein;
FT                   RNA polymerase dimerisation; RNA polymerase insert; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59610"
FT                   /db_xref="GOA:B1YGX7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGX7"
FT                   /protein_id="ACB59610.1"
FT                   /translation="MIEIEKPKIETVELSDNATFGKFVVEPLERGFGTTLGNSLRRILL
FT                   SSLPGAAVTAVQIDGVLHEFSTIDGVVEDVTQIILNLKKLALKVYSEEEKTLEIDIQGA
FT                   GVVTAANITHDSDVEILNPELHIATLAEGASLHMRLTARRGRGYVQAEDNKRDDMPIGV
FT                   IPIDSIYTPIQRVNYQVEKTRVGQDASFDKLTLDVWTDGSIRPEEAVSLGAKIMTEHLN
FT                   IFVGLTDEALHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKS
FT                   EDEMMKVRNLGRKSLEEVQAKLDELGLGLRKED"
     MIEIEKPKIE TVELSDNATF GKFVVEPLER GFGTTLGNSL RRILLSSLPG AAVTAVQIDG        60
     VLHEFSTIDG VVEDVTQIIL NLKKLALKVY SEEEKTLEID IQGAGVVTAA NITHDSDVEI       120
     LNPELHIATL AEGASLHMRL TARRGRGYVQ AEDNKRDDMP IGVIPIDSIY TPIQRVNYQV       180
     EKTRVGQDAS FDKLTLDVWT DGSIRPEEAV SLGAKIMTEH LNIFVGLTDE ALHAEIMVEK       240
     EEDQKEKVLE MTIEELDLSV RSYNCLKRAG INTVQELANK SEDEMMKVRN LGRKSLEEVQ       300
     AKLDELGLGL RKED                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page