(data stored in ACNUC7421 zone)

EMBL: CP001022.PE123

CP001022.PE123       Location/Qualifiers
FT   CDS             139234..139605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0124"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG: bcl:ABC0178 50S
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59611"
FT                   /db_xref="GOA:B1YGX8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGX8"
FT                   /protein_id="ACB59611.1"
FT                   /translation="MAYSKLGRTSSQRKALLRDLATDLIINERIQTTEQKAKELRPVVE
FT                   KLITLGKRGDLHARRQVASFVRREAAGQNEAGKTQDAIQKLFADVAPRFAERQGGYTRI
FT                   MKMGPRRGDGAEMVIIELV"
     MAYSKLGRTS SQRKALLRDL ATDLIINERI QTTEQKAKEL RPVVEKLITL GKRGDLHARR        60
     QVASFVRREA AGQNEAGKTQ DAIQKLFADV APRFAERQGG YTRIMKMGPR RGDGAEMVII       120
     ELV                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page