(data stored in ACNUC7421 zone)

EMBL: CP001022.PE124

CP001022.PE124       Location/Qualifiers
FT   CDS             139702..140532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0125"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: lwe:lwe2551 cobalt ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59612"
FT                   /db_xref="GOA:B1YGX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGX9"
FT                   /protein_id="ACB59612.1"
FT                   /translation="MTKLIELEQVTYRYPEQEQPALRNVSLSIHSQEWVAIVGHNGSGK
FT                   STLTKLFNGLLLPEEGTVTVNETFSSAVPEQLWEMRRAIGIVFQNPDNQFVGTTVRDDV
FT                   AFALENWGVPREEMVRRIDDSLARVGLTDFVDREPHQLSGGQKQRVAIASALAMRPDVL
FT                   VLDEATSMLDPIARTEVMSTVQELYEQHPMAVVAITHELDEVLRASRVIVMDAGQIVLE
FT                   GTPQEVFAQSAFLEQIGLDVPFVVRVQEQLSVRGLTYEDTILDERDLVNRLCQS"
     MTKLIELEQV TYRYPEQEQP ALRNVSLSIH SQEWVAIVGH NGSGKSTLTK LFNGLLLPEE        60
     GTVTVNETFS SAVPEQLWEM RRAIGIVFQN PDNQFVGTTV RDDVAFALEN WGVPREEMVR       120
     RIDDSLARVG LTDFVDREPH QLSGGQKQRV AIASALAMRP DVLVLDEATS MLDPIARTEV       180
     MSTVQELYEQ HPMAVVAITH ELDEVLRASR VIVMDAGQIV LEGTPQEVFA QSAFLEQIGL       240
     DVPFVVRVQE QLSVRGLTYE DTILDERDLV NRLCQS                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page