(data stored in ACNUC7421 zone)

EMBL: CP001022.PE126

CP001022.PE126       Location/Qualifiers
FT   CDS             141374..142165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0127"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG:
FT                   bay:RBAM_001720 YbaF"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59614"
FT                   /db_xref="GOA:B1YH82"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YH82"
FT                   /protein_id="ACB59614.1"
FT                   /translation="MIVGQHIPGTSYLHRSSAVAKIIFAFCFIPLVFLANNAATNIFLL
FT                   LFTFFALASSKLPIRYVLKGLRPILFLIIFTFIIQLLFTREGAVLFEFGWFKIYEEGLR
FT                   LAIIVSLRFFYLVSITTLVTLTTSPIELTDAIELLLKPFKVVRVPTHEIALMLSISLRF
FT                   LPTLAEETEKIMKAQQARGVDLSAGPIKERLRAIIPLLIPLFISAFKRAEDLATAMEAR
FT                   GYRGGEGRTRLRESKWTTRDTGLILLLVALGLLLVYLRGGF"
     MIVGQHIPGT SYLHRSSAVA KIIFAFCFIP LVFLANNAAT NIFLLLFTFF ALASSKLPIR        60
     YVLKGLRPIL FLIIFTFIIQ LLFTREGAVL FEFGWFKIYE EGLRLAIIVS LRFFYLVSIT       120
     TLVTLTTSPI ELTDAIELLL KPFKVVRVPT HEIALMLSIS LRFLPTLAEE TEKIMKAQQA       180
     RGVDLSAGPI KERLRAIIPL LIPLFISAFK RAEDLATAME ARGYRGGEGR TRLRESKWTT       240
     RDTGLILLLV ALGLLLVYLR GGF                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page