(data stored in ACNUC7421 zone)

EMBL: CP001022.PE129

CP001022.PE129       Location/Qualifiers
FT   CDS             143536..143928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0130"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: bcl:ABC0184 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59617"
FT                   /db_xref="GOA:B1YH85"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YH85"
FT                   /protein_id="ACB59617.1"
FT                   /translation="MADVRYYGTGRRKHAAARVFLVAGDGKVTVNGRDISEYFGYETLI
FT                   MTAKEPLVLTETEGKYDIMVTVKGGGFTGQAGAIRHGISRALLQADPDFRGTLKAKGFL
FT                   TRDARMKERKKYGLKAARRAPQFSKR"
     MADVRYYGTG RRKHAAARVF LVAGDGKVTV NGRDISEYFG YETLIMTAKE PLVLTETEGK        60
     YDIMVTVKGG GFTGQAGAIR HGISRALLQA DPDFRGTLKA KGFLTRDARM KERKKYGLKA       120
     ARRAPQFSKR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page