(data stored in ACNUC7421 zone)

EMBL: CP001022.PE132

CP001022.PE132       Location/Qualifiers
FT   CDS             145230..146261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0133"
FT                   /product="ATP-binding Mrp protein"
FT                   /note="KEGG: bcl:ABC0195 ATP-binding Mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59620"
FT                   /db_xref="GOA:B1YH88"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH88"
FT                   /protein_id="ACB59620.1"
FT                   /translation="MLNEQEIREVVGQMIDPTIERSLTDTNGIRDVRIKGDYVSLKIAL
FT                   AQAGSGEQLALQQQIVKELKEKGFKTVGLRFEALGDHGIQAATTPSILKPESGTTFIAI
FT                   ASGKGGVGKSTVSVNLAVALARAGKKVGLIDADIYGFSVPDMMGIETRPTVVNDRIVPP
FT                   ERFGVKVISMGFFVEDNAPVIWRGPMLGKMLNNFFSDVEWGDLDYLLLDLPPGTGDVAL
FT                   DIHSMLPSCQELIVTTPHATAAFVAARAGAMAIKTNHRLLGIIENMAYFESKVTGEKEY
FT                   VFGSGGGEKLSEALKTDILAKIPLGQPYANDTDFAPSIYRDDHPFETHYNELAARVIEK
FT                   VEG"
     MLNEQEIREV VGQMIDPTIE RSLTDTNGIR DVRIKGDYVS LKIALAQAGS GEQLALQQQI        60
     VKELKEKGFK TVGLRFEALG DHGIQAATTP SILKPESGTT FIAIASGKGG VGKSTVSVNL       120
     AVALARAGKK VGLIDADIYG FSVPDMMGIE TRPTVVNDRI VPPERFGVKV ISMGFFVEDN       180
     APVIWRGPML GKMLNNFFSD VEWGDLDYLL LDLPPGTGDV ALDIHSMLPS CQELIVTTPH       240
     ATAAFVAARA GAMAIKTNHR LLGIIENMAY FESKVTGEKE YVFGSGGGEK LSEALKTDIL       300
     AKIPLGQPYA NDTDFAPSIY RDDHPFETHY NELAARVIEK VEG                         343
//

If you have problems or comments...

PBIL Back to PBIL home page