(data stored in ACNUC7421 zone)

EMBL: CP001022.PE135

CP001022.PE135       Location/Qualifiers
FT   CDS             154091..154654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0136"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; RNA polymerase sigma-W factor; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: bld:BLi00199 RNA polymerase
FT                   sigma factor SigW"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59623"
FT                   /db_xref="GOA:B1YH91"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH91"
FT                   /protein_id="ACB59623.1"
FT                   /translation="MEETTLRLIERVKQGDRDAFAALVDLYKEGAFLVAFRVLRDRMEA
FT                   EDATQEAFIRVFTKIESYNAQWKFRTWLYRIVTNVSIDRLRKKRPDYSLDAEMSGTEGL
FT                   TLYSQLESKDQLPEDQVIDSEQRQDVGEAIAGLPEKYRIPLVLKYVEDLSLKEISEMID
FT                   LPVATVKTRIHRGREALKKHFGKR"
     MEETTLRLIE RVKQGDRDAF AALVDLYKEG AFLVAFRVLR DRMEAEDATQ EAFIRVFTKI        60
     ESYNAQWKFR TWLYRIVTNV SIDRLRKKRP DYSLDAEMSG TEGLTLYSQL ESKDQLPEDQ       120
     VIDSEQRQDV GEAIAGLPEK YRIPLVLKYV EDLSLKEISE MIDLPVATVK TRIHRGREAL       180
     KKHFGKR                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page