(data stored in ACNUC7421 zone)

EMBL: CP001022.PE141

CP001022.PE141       Location/Qualifiers
FT   CDS             complement(161423..162685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_012450 viral A-type inclusion
FT                   protein, putative Pfam: LRR_1 P4Ha_N HALZ bZIP_1 DUF904
FT                   EzrA DUF465 PLU-1 Baculo_PEP_C HR1 Not3 Alpha-2-MRAP_C
FT                   Myosin_tail_1 Microtub_assoc DegQ DUF1409 PspA_IM30
FT                   Tropomyosin TBPIP SspO PMC2NT Filament Laminin_I DUF827
FT                   TPR_MLP1_2 Prefoldin_2 Troponin Mod_r Vicilin_N
FT                   Apolipoprotein ATG16 Snf7 MbeD_MobD Spectrin Osmo_CC DUF837
FT                   IF2_N Rab5-bind Herpes_BLRF2 PROSITE: ASN_RICH GLU_RICH
FT                   LYS_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59629"
FT                   /db_xref="GOA:B1YH97"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH97"
FT                   /protein_id="ACB59629.1"
FT                   /translation="MDNALGIIAVIIILLLFSYLLFRKFSRHDAVTDSVLPPIPAKTDV
FT                   PELHADELPWEIESYFLTDMTSYRHSESLTVTQRLKDQVGNIIKLSPHAKNLIQKEQRV
FT                   IIKFSEEALAKLASGELRIMKAKGSVDQFRALAVDHQHKIRHHAKFEIQDIKKINPAQL
FT                   ANLALGVATMVTAQEHLDRINQQLTSLNRKIDILIRQSKNDKAGIIKGHIKYLLSILPS
FT                   IPDEEERYSVKLEDMAVISYQELESILPELDFLIRSANDIEEKTTFKLDKTVDEIKELA
FT                   ASFEQTILIGYGNLEVMSICLKIMNDWNQDSQTNATRLSDIEKYHQQITEYHHKFEKIL
FT                   SDKHVSIDATFRRNKTITSKKEDIDKQLTYHQEKIRSSKSIITDHIIQLKGQDYDSIPE
FT                   PVDLSVDFDETGDIHTIHRLK"
     MDNALGIIAV IIILLLFSYL LFRKFSRHDA VTDSVLPPIP AKTDVPELHA DELPWEIESY        60
     FLTDMTSYRH SESLTVTQRL KDQVGNIIKL SPHAKNLIQK EQRVIIKFSE EALAKLASGE       120
     LRIMKAKGSV DQFRALAVDH QHKIRHHAKF EIQDIKKINP AQLANLALGV ATMVTAQEHL       180
     DRINQQLTSL NRKIDILIRQ SKNDKAGIIK GHIKYLLSIL PSIPDEEERY SVKLEDMAVI       240
     SYQELESILP ELDFLIRSAN DIEEKTTFKL DKTVDEIKEL AASFEQTILI GYGNLEVMSI       300
     CLKIMNDWNQ DSQTNATRLS DIEKYHQQIT EYHHKFEKIL SDKHVSIDAT FRRNKTITSK       360
     KEDIDKQLTY HQEKIRSSKS IITDHIIQLK GQDYDSIPEP VDLSVDFDET GDIHTIHRLK       420
//

If you have problems or comments...

PBIL Back to PBIL home page