(data stored in ACNUC7421 zone)

EMBL: CP001022.PE142

CP001022.PE142       Location/Qualifiers
FT   CDS             162805..163377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59630"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH98"
FT                   /protein_id="ACB59630.1"
FT                   /translation="MNRKWNWAAAFPQSCTDDVRVVARLLPRRLFGTVTWGTIEVTFYG
FT                   EPLILPYRLYLNEVKEEKIQTLTDRQRWILYCMYTRHHDGYIREKHVRRLEQEQAKTDW
FT                   VLLYLIELTGEYVREILERIEPMLQIWSEEQLRTFAAANKRYLQRIERRIISYWDLHQR
FT                   RDYPVLWNSDYVGFRIAQYYWSSRAHS"
     MNRKWNWAAA FPQSCTDDVR VVARLLPRRL FGTVTWGTIE VTFYGEPLIL PYRLYLNEVK        60
     EEKIQTLTDR QRWILYCMYT RHHDGYIREK HVRRLEQEQA KTDWVLLYLI ELTGEYVREI       120
     LERIEPMLQI WSEEQLRTFA AANKRYLQRI ERRIISYWDL HQRRDYPVLW NSDYVGFRIA       180
     QYYWSSRAHS                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page