(data stored in ACNUC7421 zone)

EMBL: CP001022.PE146

CP001022.PE146       Location/Qualifiers
FT   CDS             165261..167582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0147"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: bha:BH0336 hypothetical protein; TIGRFAM:
FT                   CRISPR-associated helicase Cas3; CRISPR-associated HD
FT                   domain protein; PFAM: helicase domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; DEAD/DEAH
FT                   box helicase domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59634"
FT                   /db_xref="GOA:B1YHA2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA2"
FT                   /protein_id="ACB59634.1"
FT                   /translation="MRYIAHVHSTDGKIQEVKTHLLEARGLAENWGKDIGLMHVCGVAG
FT                   LLHDIGKLSDEFQTYIRKATSGEHVRRGEVDHATAGGRLLFEQLKGNRGQLLAEMVANA
FT                   ILSHHGNLQDYYLEEESPFLQRVERKELPSYKMCRERFFQVVIDEQEFNRYVERAVDEL
FT                   YSWILRDGGSTARVSLATKYIFSILLDADRTNTREFEQGITTMTTQVDFEELKRRLETH
FT                   LSTFSQQTEITPINRLRQEMSDACRVFANQPSGVYTLSIPTGGGKTLASLRYALHHATT
FT                   YQKKRIIYVVPFTTIIEQNARVARDVLGTDMILEHHSNVVEIEDASDDVMDIQAKLHLA
FT                   KDNWDAPIIFTTMVQYLNTFYAKGNRNTRRLHHLSEAIIIFDEVQKVPLKCISLFNESV
FT                   KFLKDSLESSVVLCTATQPALEFVKYQLHQDGEMIDALPQVMEAFRRTDLEVVEGEMDT
FT                   ARLAEVVTRQVEEKNSVLVILNTKSVVKKLYETLRQQHPDEEVIHLSTAMCAAHRMDIL
FT                   RTINQRLEQGERIICISTQLIEAGVDVSFACVIRSLAGLDSIAQAAGRCNRHGEVARQT
FT                   VYLVDHIEENLKHLPEIARGKEIVRAILIDFLRDEQSYEGNLLGTVAMTRYFQELYDAS
FT                   EVELDFPIRGTTLTLAPMLFKPRKVPELILSSRHRTVANHFKVIEDMTETVLVPYGEEG
FT                   KRLIASLNGQADWEDLRKWLKQAQQYSINLHAHERKKLEATQGLNVILDGTVLVLSERA
FT                   YDDHYGLNLEQDSLLEDLMM"
     MRYIAHVHST DGKIQEVKTH LLEARGLAEN WGKDIGLMHV CGVAGLLHDI GKLSDEFQTY        60
     IRKATSGEHV RRGEVDHATA GGRLLFEQLK GNRGQLLAEM VANAILSHHG NLQDYYLEEE       120
     SPFLQRVERK ELPSYKMCRE RFFQVVIDEQ EFNRYVERAV DELYSWILRD GGSTARVSLA       180
     TKYIFSILLD ADRTNTREFE QGITTMTTQV DFEELKRRLE THLSTFSQQT EITPINRLRQ       240
     EMSDACRVFA NQPSGVYTLS IPTGGGKTLA SLRYALHHAT TYQKKRIIYV VPFTTIIEQN       300
     ARVARDVLGT DMILEHHSNV VEIEDASDDV MDIQAKLHLA KDNWDAPIIF TTMVQYLNTF       360
     YAKGNRNTRR LHHLSEAIII FDEVQKVPLK CISLFNESVK FLKDSLESSV VLCTATQPAL       420
     EFVKYQLHQD GEMIDALPQV MEAFRRTDLE VVEGEMDTAR LAEVVTRQVE EKNSVLVILN       480
     TKSVVKKLYE TLRQQHPDEE VIHLSTAMCA AHRMDILRTI NQRLEQGERI ICISTQLIEA       540
     GVDVSFACVI RSLAGLDSIA QAAGRCNRHG EVARQTVYLV DHIEENLKHL PEIARGKEIV       600
     RAILIDFLRD EQSYEGNLLG TVAMTRYFQE LYDASEVELD FPIRGTTLTL APMLFKPRKV       660
     PELILSSRHR TVANHFKVIE DMTETVLVPY GEEGKRLIAS LNGQADWEDL RKWLKQAQQY       720
     SINLHAHERK KLEATQGLNV ILDGTVLVLS ERAYDDHYGL NLEQDSLLED LMM              773
//

If you have problems or comments...

PBIL Back to PBIL home page