(data stored in ACNUC7421 zone)

EMBL: CP001022.PE149

CP001022.PE149       Location/Qualifiers
FT   CDS             170173..171030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0150"
FT                   /product="CRISPR-associated protein, Csd2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, CT1132 family;
FT                   CRISPR-associated protein, Csd2 family; PFAM:
FT                   CRISPR-associated protein TM1801; KEGG: bcl:ABC3594
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59637"
FT                   /db_xref="GOA:B1YHA5"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013418"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA5"
FT                   /protein_id="ACB59637.1"
FT                   /translation="MTTLDRKIDFTVILSVTKANPNGDPLNGNRPRQNYDGYGEISDVA
FT                   IKRKIRNRLQDMGESIFVQSNDRNLDGYASLRDRAEANDTIKKLMKTKNASDQVAAEAC
FT                   ATWMDVRAFGQVFAFKGDKAGGVSVGVRGPVSIHTATSVAPIDVTSMQITKSVNSESGK
FT                   ERGSDTMGMKHRVDHGVYVFNGSINTQLAEKTNFTQEDAEKFKLALVSLFENDASSARP
FT                   EGSMEVHKVYWWEHDSKLGRFSSAKVHRAVSVQALTDEPKSFLDYEIKVDALEGFTPEI
FT                   LDGL"
     MTTLDRKIDF TVILSVTKAN PNGDPLNGNR PRQNYDGYGE ISDVAIKRKI RNRLQDMGES        60
     IFVQSNDRNL DGYASLRDRA EANDTIKKLM KTKNASDQVA AEACATWMDV RAFGQVFAFK       120
     GDKAGGVSVG VRGPVSIHTA TSVAPIDVTS MQITKSVNSE SGKERGSDTM GMKHRVDHGV       180
     YVFNGSINTQ LAEKTNFTQE DAEKFKLALV SLFENDASSA RPEGSMEVHK VYWWEHDSKL       240
     GRFSSAKVHR AVSVQALTDE PKSFLDYEIK VDALEGFTPE ILDGL                       285
//

If you have problems or comments...

PBIL Back to PBIL home page