(data stored in ACNUC7421 zone)

EMBL: CP001022.PE151

CP001022.PE151       Location/Qualifiers
FT   CDS             171679..172710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0152"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: bha:BH0341
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59639"
FT                   /db_xref="GOA:B1YHA7"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019856"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA7"
FT                   /protein_id="ACB59639.1"
FT                   /translation="MKKLLNTLFINQSDSYLALDGGNVLVKADGQVLGRVPLHNLEGIV
FT                   AFGYTGASPALMGHCAENGIALTFMTKNGRFLARVIGESRGNVVLRKTQYRRSDDEVAS
FT                   ARLAKNFILGKLYNQKWMLERMTRDYPLRLDVERFKTTSQDMTETMREIQVCENLERLR
FT                   GLEGTIAVRYNRLFDSMILQQKEDFHFKGRTRRPPLDRVNAMLSFAYSLLARDVSAALE
FT                   AVGLDAYVGFLHRERPGRASLALDVMEELRGIYADRFVLSLINKKVIQGKDFLQKENGA
FT                   VIMTEEGRKTFLTAWQKKKQETIQHPYLKEKMMWGLVPYEQALLLARHLRDDLEAYPPF
FT                   LYK"
     MKKLLNTLFI NQSDSYLALD GGNVLVKADG QVLGRVPLHN LEGIVAFGYT GASPALMGHC        60
     AENGIALTFM TKNGRFLARV IGESRGNVVL RKTQYRRSDD EVASARLAKN FILGKLYNQK       120
     WMLERMTRDY PLRLDVERFK TTSQDMTETM REIQVCENLE RLRGLEGTIA VRYNRLFDSM       180
     ILQQKEDFHF KGRTRRPPLD RVNAMLSFAY SLLARDVSAA LEAVGLDAYV GFLHRERPGR       240
     ASLALDVMEE LRGIYADRFV LSLINKKVIQ GKDFLQKENG AVIMTEEGRK TFLTAWQKKK       300
     QETIQHPYLK EKMMWGLVPY EQALLLARHL RDDLEAYPPF LYK                         343
//

If you have problems or comments...

PBIL Back to PBIL home page