(data stored in ACNUC7421 zone)

EMBL: CP001022.PE152

CP001022.PE152       Location/Qualifiers
FT   CDS             172724..173014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0153"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   protein of unknown function DUF196; KEGG: bha:BH0342
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59640"
FT                   /db_xref="GOA:B1YHA8"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA8"
FT                   /protein_id="ACB59640.1"
FT                   /translation="MLVLITYDVNTVSPGGKKRLRHVAKLCQRYGQRVQNSVFECIVDQ
FT                   TEFMLLKLRLKEIINHERDSLRFYKLGNQYISKVEHYGIKSSLDVEGPLIF"
     MLVLITYDVN TVSPGGKKRL RHVAKLCQRY GQRVQNSVFE CIVDQTEFML LKLRLKEIIN        60
     HERDSLRFYK LGNQYISKVE HYGIKSSLDV EGPLIF                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page