(data stored in ACNUC7421 zone)

EMBL: CP001022.PE156

CP001022.PE156       Location/Qualifiers
FT   CDS             176861..177712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0157"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bth:BT_0778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59644"
FT                   /db_xref="GOA:B1YHB2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB2"
FT                   /protein_id="ACB59644.1"
FT                   /translation="MDIKKYRVTPGESIHLSDYPTSDENRIAEDELLDQHIPKSVEELK
FT                   ELHWRLHAEEKNGVLVILQAIDAGGKDEAISYIFSNLNAQGLRTLSVKKPSDTEKKHDY
FT                   LWRIHEGLPEKGEVGILNRSYYEEVIAPRIHDLLEEEEVPDDQDVWKMRYRQINDFERY
FT                   LVENGFRVVKFLFNVSKDEQKKRLLERIKDPKKNFEFSFSDVEEREHWDEYQDIFAELV
FT                   SHTSTEHAPWHVLPADDEWFTRYIVTEVMNDVLREIDPQYPKLTDEDQEKLDEAIKKLE
FT                   NE"
     MDIKKYRVTP GESIHLSDYP TSDENRIAED ELLDQHIPKS VEELKELHWR LHAEEKNGVL        60
     VILQAIDAGG KDEAISYIFS NLNAQGLRTL SVKKPSDTEK KHDYLWRIHE GLPEKGEVGI       120
     LNRSYYEEVI APRIHDLLEE EEVPDDQDVW KMRYRQINDF ERYLVENGFR VVKFLFNVSK       180
     DEQKKRLLER IKDPKKNFEF SFSDVEEREH WDEYQDIFAE LVSHTSTEHA PWHVLPADDE       240
     WFTRYIVTEV MNDVLREIDP QYPKLTDEDQ EKLDEAIKKL ENE                         283
//

If you have problems or comments...

PBIL Back to PBIL home page