(data stored in ACNUC7421 zone)

EMBL: CP001022.PE160

CP001022.PE160       Location/Qualifiers
FT   CDS             179458..179928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0161"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   bpu:BPUM_1773 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59648"
FT                   /db_xref="GOA:B1YHB6"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB6"
FT                   /protein_id="ACB59648.1"
FT                   /translation="MTLGIVLALFGGMMVCIQNTFNAKVKEQVGAWATTTLVLGLGFLA
FT                   SLTIGLLVEGGGLFSTSGMQPWFWFSGIIGVGVVLCVTQGVQQLGPSYAISIVMVSQIL
FT                   FALLWDTLGWFGLDQVAFTWTKAVGVVLIGGGVLLFQLGGKLTERRMLRKGA"
     MTLGIVLALF GGMMVCIQNT FNAKVKEQVG AWATTTLVLG LGFLASLTIG LLVEGGGLFS        60
     TSGMQPWFWF SGIIGVGVVL CVTQGVQQLG PSYAISIVMV SQILFALLWD TLGWFGLDQV       120
     AFTWTKAVGV VLIGGGVLLF QLGGKLTERR MLRKGA                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page