(data stored in ACNUC7421 zone)

EMBL: CP001022.PE161

CP001022.PE161       Location/Qualifiers
FT   CDS             179932..180645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0162"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bld:BLi00219 YfnB"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59649"
FT                   /db_xref="GOA:B1YHB7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB7"
FT                   /protein_id="ACB59649.1"
FT                   /translation="MNYTTLLFDIDHTLLDFDATERAALRQLFEDEQLEWTEEREARYR
FT                   TINRSLWQALERGEITRQEVITSRFVTFFAEQGRTVDGSRMDTRYRAYLSQGTELIAGA
FT                   IELLDSLKEKYQLYVVTNGVAATQRARLKGSGLAPYFDGIFVSEETGYQKPMPAFFDYV
FT                   FDRIPNVRRDQTIIIGDSLTADIQGGILAGIATCWFNPTHAAAPAELMPTYTINQLNQL
FT                   VTLLGTKEVVWTTSK"
     MNYTTLLFDI DHTLLDFDAT ERAALRQLFE DEQLEWTEER EARYRTINRS LWQALERGEI        60
     TRQEVITSRF VTFFAEQGRT VDGSRMDTRY RAYLSQGTEL IAGAIELLDS LKEKYQLYVV       120
     TNGVAATQRA RLKGSGLAPY FDGIFVSEET GYQKPMPAFF DYVFDRIPNV RRDQTIIIGD       180
     SLTADIQGGI LAGIATCWFN PTHAAAPAEL MPTYTINQLN QLVTLLGTKE VVWTTSK          237
//

If you have problems or comments...

PBIL Back to PBIL home page